PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family MIKC_MADS
Protein Properties Length: 175aa    MW: 19990.3 Da    PI: 10.0517
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015921genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.61.9e-291059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 rien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gkl+e++s
  DCAR_015921 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSTRGKLFEFAS 59
                 8***********************************************86 PP

2K-box75.51.4e-2579171698
        K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  +k    +++++l+ e a L k+ie L+  +R+llGe+L+s++l+e+qq+eqqLeks+ +iR++K++++ eqie+l++kek l  +n  L++k 
  DCAR_015921  79 NKTPVVQDMQHLKLETACLAKKIELLEVAKRKLLGEGLGSCTLEEIQQVEQQLEKSVCTIRDRKMKVYNEQIEQLKEKEKTLAADNAILSAKR 171
                  455566789********************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.539161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002657.04E-43378No hitNo description
SuperFamilySSF554559.81E-33375IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-31323IPR002100Transcription factor, MADS-box
PfamPF003198.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014868.2E-2486170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.52987174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFST RGKLFEFASS  60
SMHDMIERYR KCTKDVHSNK TPVVQDMQHL KLETACLAKK IELLEVAKRK LLGEGLGSCT  120
LEEIQQVEQQ LEKSVCTIRD RKMKVYNEQI EQLKEKEKTL AADNAILSAK RSEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D6e-20369268Myocyte-specific enhancer factor 2A
3mu6_C6e-20369268Myocyte-specific enhancer factor 2A
3mu6_B6e-20369268Myocyte-specific enhancer factor 2A
3mu6_A6e-20369268Myocyte-specific enhancer factor 2A
1egw_D7e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C7e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B7e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A7e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J7e-20369268Myocyte-specific enhancer factor 2A
3p57_I7e-20369268Myocyte-specific enhancer factor 2A
3p57_D7e-20369268Myocyte-specific enhancer factor 2A
3p57_C7e-20369268Myocyte-specific enhancer factor 2A
3p57_B7e-20369268Myocyte-specific enhancer factor 2A
3p57_A7e-20369268Myocyte-specific enhancer factor 2A
3kov_J7e-20369268Myocyte-specific enhancer factor 2A
3kov_I7e-20369268Myocyte-specific enhancer factor 2A
3kov_B7e-20369268Myocyte-specific enhancer factor 2A
3kov_A7e-20369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843634.11e-89PREDICTED: MADS-box protein SOC1
RefseqXP_012843635.11e-89PREDICTED: MADS-box protein SOC1
SwissprotO646455e-82SOC1_ARATH; MADS-box protein SOC1
TrEMBLO816621e-103O81662_PIMBR; Transcription activator
STRINGGLYMA18G45780.13e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.16e-74AGAMOUS-like 20